y7iq ✓ WhySevenIQ - Self Directed Iras, Ira, Retirement Planning

Pagespeed Score

Desktop	72/100	❗
Mobile	43/100	✘

Optimization Stats

Field	Data	Result
Page Size	58 KB	✔
Compression	10 KB (-82.1%)	✔
Text/Html Ratio	1018 / 59316 (bytes) = 1.72%	❗
Load Time	0.53 second	✔
Mobile Ready	0/100	✘
In-Page Links	2	✔
Doc Type	HTML 5	✔
Encoding	UTF-8	✔
Declared Language	EN-US	✔
Preferred Domain	Yes	✔
Robots.txt	No	✘
Url Rewrite	No	✔
Underscores in url	No	✔
Images Without ALT	0 / 0	✔
Embedded Objects (Desktop)	No	✔
Embedded Objects (Mobile)	No	✔
Iframe	No	✔
Custom 404 page	No	✘
Email Privacy	No	✘
Gsafe browsing	Yes	✔
Analytics	No	✘
W3C Validity	No	✘

Keyword Consistency ❗

Keywords	Freq	Title	Desc	<H>
whyseveniq	9	✔	✘	✔
coming	6	✘	✘	✔
soonwelcome	5	✘	✘	✘
excitementgenerate	3	✘	✘	✘
business	3	✘	✘	✘
comingsoonwelcome	2	✘	✘	✘
something	2	✘	✘	✘
normal	1	✘	✘	✘
love	1	✘	✘	✘
feel	1	✘	✘	✘
free	1	✘	✘	✘
visit	1	✘	✘	✘
during	1	✘	✘	✘
whyseveniqwhyseveniqwhyseveniqwhyseveniqwhyseveniqwhyseveniqwhyseveniqwhyseveniqmore-------------------------welcome	1	✘	✘	✘
contact	1	✘	✘	✔

54/100

Update

July, 23 2020

With 0.53 seconds in page load, 58 KB of page size and all other reports below, the y7iq.com has a SEO score of 54 out of 100

Meta tags data

Title	WhySevenIQ - Self Directed Iras, Ira, Retirement Planning
Description	self directed iras
Keyword

Domain Registration

Age	0 Years, 5 Days
Created	18th-Jul-2020
Updated	18th-Jul-2020
Expiry	18th-Jul-2021

DNS Data

Host	Type	Ttl	Other
y7iq.com	A	587	ip:182.50.132.242
y7iq.com	NS	3600	target:ns28.domaincontrol.com
y7iq.com	NS	3600	target:ns27.domaincontrol.com
y7iq.com	SOA	3600	mname:ns27.domaincontrol.com rname:dns.jomax.net serial:2020071806 refresh:28800 retry:7200 expire:604800 minimum-ttl:600
y7iq.com	MX	3600	pri:0 target:y7iq-com.mail.protection.outlook.com
y7iq.com	TXT	3600	txt:v=spf1 include:spf.protection.outlook.com -all

http Headers

WHOIS Data

Domain Name: y7iq.com
Registry Domain ID: 2546845222_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2020-07-18T01:44:57Z
Creation Date: 2020-07-18T01:44:56Z
Registrar Registration Expiration Date: 2021-07-18T01:44:56Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization: WhySevenIQ
Registrant State/Province: Washington
Registrant Country: US
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=y7iq.com
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=y7iq.com
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=y7iq.com
Name Server: NS27.DOMAINCONTROL.COM
Name Server: NS28.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-07-23T04:00:00Z

Server Location

Server IP	160.153.136.3
Server Location	Netherlands
Service Provider	Host Europe GmbH

Domain Availability

Domains (TLD)	Status
y7iq.net	Available
y7iq.org	Available
y7iq.biz	Already Registered
y7iq.io	Already Registered
y7iq.info	Available

Typo Availability

Domains (TLD)	Status
t7iq.com	Available
g7iq.com	Available
h7iq.com	Available
j7iq.com	Available
u7iq.com	Available

Check More

Festival-opery-mikulov.com

1915w82nd.com

Magfashioneducation.com

Y7iq.com SEO Analysis